CDS

Accession Number TCMCG044C68008
gbkey CDS
Protein Id XP_026424277.1
Location complement(join(122416627..122416929,122417186..122417210,122417318..122417325))
Gene LOC113320588
GeneID 113320588
Organism Papaver somniferum

Protein

Length 111aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA492326
db_source XM_026568492.1
Definition U1 small nuclear ribonucleoprotein C-like [Papaver somniferum]

EGGNOG-MAPPER Annotation

COG_category A
Description Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region
KEGG_TC -
KEGG_Module M00351        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko03041        [VIEW IN KEGG]
KEGG_ko ko:K11095        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03040        [VIEW IN KEGG]
map03040        [VIEW IN KEGG]
GOs GO:0000243        [VIEW IN EMBL-EBI]
GO:0000245        [VIEW IN EMBL-EBI]
GO:0000375        [VIEW IN EMBL-EBI]
GO:0000377        [VIEW IN EMBL-EBI]
GO:0000395        [VIEW IN EMBL-EBI]
GO:0000398        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005681        [VIEW IN EMBL-EBI]
GO:0005684        [VIEW IN EMBL-EBI]
GO:0005685        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006376        [VIEW IN EMBL-EBI]
GO:0006396        [VIEW IN EMBL-EBI]
GO:0006397        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008380        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016070        [VIEW IN EMBL-EBI]
GO:0016071        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0022618        [VIEW IN EMBL-EBI]
GO:0030532        [VIEW IN EMBL-EBI]
GO:0030627        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0036002        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045292        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0071010        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071826        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0097525        [VIEW IN EMBL-EBI]
GO:0120114        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGCATCGACGCCGTCGTCACCATTCCGGTTCGGCAAATAGGCCTACACATGATCAACAATTAGAAGCGGAACAAATCCAAAGTTTGATTGATCAAAGGATCAAAGAGCATCTTGGTGGTGCAGGATCCCAACAAGTTGGTGCTGCTTTCAACCAGCATCTTGACTCTTACCCACAGAGACCTTGTCTTCCAGTCATGCTTCCAACTGGTATGCCTGCATATGGATCACAAATGCCCGAAGCCGAACAAACCCAAAGTATGATAACTTTGATTGATCGGAGGATCAAAGATCATCTTGGTGCTGCAGGATTCCAACCAGCTGTTATTCCAGGTTAA
Protein:  
MHRRRRHHSGSANRPTHDQQLEAEQIQSLIDQRIKEHLGGAGSQQVGAAFNQHLDSYPQRPCLPVMLPTGMPAYGSQMPEAEQTQSMITLIDRRIKDHLGAAGFQPAVIPG